PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009802877.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 248aa    MW: 27959.6 Da    PI: 7.9689
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009802877.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1842.5e-2679165290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     +Y++YA+++GF +r+++ ++s rnge ++r++vC+keg++++++++  + +r+    r gCka++ vkke++gkw+v+kl++eH+H+l+
  XP_009802877.1  79 YYSTYATHLGFVMRVDAFRRSMRNGELVWRRLVCNKEGFSKSRQNQ--NGKRKCRAIREGCKAMIIVKKEQSGKWVVAKLVKEHSHPLV 165
                     8*****************************************9988..888888899******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.8E-2579165IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MVESSSGKEL TTNGVEAEGR LNMEHYVVNE NNTTADDGEM VESSSGKELT RNGVEAEGRP  60
NLEPYVGMEF ESEEAAKAYY STYATHLGFV MRVDAFRRSM RNGELVWRRL VCNKEGFSKS  120
RQNQNGKRKC RAIREGCKAM IIVKKEQSGK WVVAKLVKEH SHPLVVKPAN TRIGSILCQT  180
PDDKDVKIRE LTAELQKERK RSAVLQEQLD MVLKDMEDHS DQLSKNINDI VKSVNELESR  240
KIVSPNGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-139HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755211e-139HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802877.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X2
RefseqXP_009802876.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1
RefseqXP_016509498.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLF6I1W91e-102F6I1W9_VITVI; Putative uncharacterized protein
TrEMBLM5VKI91e-102M5VKI9_PRUPE; Uncharacterized protein
STRINGVIT_00s0174g00120.t011e-102(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.14e-83FAR1 family protein